PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy011930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 774aa    MW: 87447.5 Da    PI: 6.253
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59548783PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.94.9e-1153997711373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL+ cA+avss+d++ a++lL+++++++s  gd  qRla++f++AL+arla+s+++ly +l+++++s    ++ ++a+++f  ++P+ k++ + aN+
  Ahy011930 399 LRTLLVLCAQAVSSDDHSTATELLKQIRQHSSRLGDGSQRLAHCFANALEARLAGSGTQLYTSLTSKRKS---AADMVKAYQMFISACPFKKLAIIFANH 495
                5789*********************************************************999998888...99************************* PP

       GRAS 101 aIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                +Il+  + +  e++HiiDf+i +G+QWpaL+  L++Rp+gpp+lRiTg++ p++g   +e+++etg+rLak++e+++vpfefn+ +a+++e++++e+L++
  Ahy011930 496 TILNLPKPKevETLHIIDFGIRYGFQWPALIFRLSKRPGGPPKLRITGIELPQPGfrPAERVQETGRRLAKYCERFNVPFEFNA-IAQKWETIKIEDLKI 594
                ****999887899*****************************************9*****************************.7************** PP

       GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                k++E laVn++++ ++llde+v l+s+rd+vLkl+++ +P++++++  + ++n++ F++rf eal +ys+lfd l++++ re+  r + E+e++gre+vn
  Ahy011930 595 KENELLAVNCMVRFKNLLDETVVLNSPRDAVLKLIRKANPNIFIHATVNGNYNAPFFVTRFREALFHYSTLFDVLDTNVDREDPMRLMFEEEFFGREVVN 694
                **************************************************************************************************** PP

       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ++aceg+er+er et+++W+ r ++aG +++pl+++   + ++ l+ v+   ++++ + + +++gWk+r +++ S+W
  Ahy011930 695 IIACEGSERVERPETYKQWQVRNTRAGVRQLPLDDHLIHKLRCKLKDVYHGDFMLDVDGNYMLQGWKGRIIYASSCW 771
                *************************************************666************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.969373752IPR005202Transcription factor GRAS
PfamPF035141.7E-112399771IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 774 aa     Download sequence    Send to blast
MDPNFNSSFL NGFRFRQVPT IPNVEEQCPD PVNGLETMNF GFMNDPFLLP PDQNNAQNPT  60
SSVSTITTAD EDSPLDDTDF SATVLRYINQ MLMEEDMEEK PCMFHDPLAL QAAEKSLYDA  120
IGGTYPHLPP HPLPPSIQHQ AQNYHNVESP DDSLSSNFSS YSSSLSTIST SNLVESHWSN  180
FDPSEYKPSI LQTSFPADFV FQASSNPGTQ SSTNNRNSFT TANNGGGLLG SSGAGFFDSS  240
FLSKSESMLQ FKRGMEEASK FLPKGNPLVI DLENSTFNPS FQKAPQHVDI KEERDEREYF  300
SGESKGRKNH EREDQVELQD GRSNKQSAIY REDSELSELF DKILLGTGCG KEAPPRCICD  360
EDKPNGQDKN VQQKEETNKF SSGKNRVKKQ GNKKGVVDLR TLLVLCAQAV SSDDHSTATE  420
LLKQIRQHSS RLGDGSQRLA HCFANALEAR LAGSGTQLYT SLTSKRKSAA DMVKAYQMFI  480
SACPFKKLAI IFANHTILNL PKPKEVETLH IIDFGIRYGF QWPALIFRLS KRPGGPPKLR  540
ITGIELPQPG FRPAERVQET GRRLAKYCER FNVPFEFNAI AQKWETIKIE DLKIKENELL  600
AVNCMVRFKN LLDETVVLNS PRDAVLKLIR KANPNIFIHA TVNGNYNAPF FVTRFREALF  660
HYSTLFDVLD TNVDREDPMR LMFEEEFFGR EVVNIIACEG SERVERPETY KQWQVRNTRA  720
GVRQLPLDDH LIHKLRCKLK DVYHGDFMLD VDGNYMLQGW KGRIIYASSC WVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-434037718374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015952243.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0L9T6I90.0A0A0L9T6I9_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SD610.0A0A0S3SD61_PHAAN; Uncharacterized protein
STRINGGLYMA11G14750.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14